PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BS_4B1025766.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 265aa    MW: 27851.7 Da    PI: 9.1564
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BS_4B1025766.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof114.16.2e-3662115558
                 zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrkn 58 
                              +cprC s++tkfCyynny++sqPr+fC+aCrryWt GG+lrnvP+Gg++rk+
  Traes_4BS_4B1025766.1  62 REQCPRCASHDTKFCYYNNYNTSQPRHFCRACRRYWTLGGSLRNVPIGGSTRKR 115
                            679*************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088427.39163117IPR003851Zinc finger, Dof-type
PfamPF027012.2E-3163115IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-2264110IPR003851Zinc finger, Dof-type
PROSITE patternPS01361065101IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MEAPLHQLAP MQQALLAHPQ NCKHDAAATM AATDMACVQQ QQQLLQLQPA AANPNTPSAA  60
AREQCPRCAS HDTKFCYYNN YNTSQPRHFC RACRRYWTLG GSLRNVPIGG STRKRLRPAP  120
QQAMRRPPVH FGAPPPPMPA QSHSQQAPQG GLLSSLFALG GAPLFEGRVG FDLGLGLPGL  180
SQVGLGGSAG EFGLHSLGLR GGHAGTSAPM LWPTAFLDNG NVDTWKVSGG GAAAMWAPEF  240
SSAPTVAQVG GNGMFHGGAQ IMGQL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3748300.0AK374830.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3077I02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559674.21e-84PREDICTED: dof zinc finger protein DOF1.7-like
TrEMBLW5EAL50.0W5EAL5_WHEAT; Uncharacterized protein
STRINGBRADI1G14570.13e-68(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.12e-26DOF zinc finger protein 1
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]